For laboratory research use only. Not for human or animal use. Not for diagnostic, therapeutic, food, drug, cosmetic, dietary supplement, household or consumer use.
Original price was: 155.00$.98.75$Current price is: 98.75$.
In stock
Product description
Semaglutide is a synthetic glucagon-like peptide-1 (GLP-1) receptor agonist supplied as a lyophilized powder for laboratory research purposes. It is a modified 31-amino-acid peptide designed to mimic native GLP-1 while exhibiting enhanced stability and extended activity. Research investigations have explored its interaction with GLP-1 receptors and its role in metabolic regulation. This product is intended exclusively for qualified laboratory research and scientific investigations.
| Weight | .0128 lbs |
|---|---|
| Dimensions | .75 × .75 × 1.5 in |
| mg | 10mg, 5mg, 2mg |
| Field | Upload-ready value |
|---|---|
| Product name | Semaglutide |
| CAS number | 910463-68-2 |
| Molecular formula | C187H291N45O59 |
| Molecular weight | 4113.58 g/mol |
| Amino acid sequence | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG (modified at positions 8 and 26) |
| Date of manufacture | Aug 30, 2022 |
| Retest date | Aug 29, 2024 |
| Storage from supplied COA | Preserve in tight containers, store at 2°C–8°C (lyophilized powder form) |
| COA Test | Result to Display |
|---|---|
| Appearance | White to off-white powder |
| Water content (Karl Fischer) | 3.2% |
| Peptide purity (HPLC) | 99.16% |
| Assay | 98.9% |
Handle only in an appropriate laboratory environment by qualified personnel using suitable PPE and institutional safety procedures. Review the SDS before handling. Biotech Labz Supply does not provide medical, veterinary, dosing, administration, or product-use advice.
